General Information

  • ID:  hor005909
  • Uniprot ID:  P01017
  • Protein name:  Angiotensin-1
  • Gene name:  AGT
  • Organism:  Bos taurus (Bovine)
  • Family:  Serpin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004867 serine-type endopeptidase inhibitor activity; GO:0005179 hormone activity; GO:0031702 type 1 angiotensin receptor binding; GO:0031703 type 2 angiotensin receptor binding
  • GO BP:  GO:0001822 kidney development; GO:0002034 maintenance of blood vessel diameter homeostasis by renin-angiotensin; GO:0003014 renal system process; GO:0003081 regulation of systemic arterial blood pressure by renin-angiotensin; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007340 acrosome reaction; GO:0008217 regulation of blood pressure; GO:0010595 positive regulation of endothelial cell migration; GO:0010718 positive regulation of epithelial to mesenchymal transition; GO:0010744 positive regulation of macrophage derived foam cell differentiation; GO:0017156 calcium-ion regulated exocytosis; GO:0038166 angiotensin-activated signaling pathway; GO:0042310 vasoconstriction; GO:0042981 regulation of apoptotic process; GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway; GO:0045893 positive regulation of DNA-templated transcription; GO:0051247 positive regulation of protein metabolic process; GO:0051387 negative regulation of neurotrophin TRK receptor signaling pathway; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0090190 positive regulation of branching involved in ureteric bud morphogenesis; GO:0097746 blood vessel diameter maintenance; GO:1901201 regulation of extracellular matrix assembly; GO:1901203 positive regulation of extracellular matrix assembly; GO:1901394 positive regulation of transforming growth factor beta1 activation; GO:1902895 positive regulation of miRNA transcription; GO:1903598 positive regulation of gap junction assembly; GO:1903779 regulation of cardiac conduction; GO:1990776 response to angiotensin; GO:2001238 positive regulation of extrinsic apoptotic signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DRVYVHPFHL
  • Length:  10(25-34)
  • Propeptide:  MAPAGLSLGAAILCLLAWAGLAAGDRVYVHPFHLLVYSKSNCDQLEKPSVETPPDPTFTPVPIQTKSSAVDEEALWEQLVRATEKLEAEDRLRASEVGLLLNFMGFHMYKTLSETWSVASGAVFSPVALFSTLTSFYVGALDPTASRLQAFLGVPGEGQGCTSRLDGHKVLSSLQTIQGLLVAQGGASSQARLLLSTVVGLFTAPGLHLKQPFVQSLSSFAPITLPRSLDLSTDPNLAAEKINRFMQSVTGWNMG
  • Signal peptide:  MAPAGLSLGAAILCLLAWAGLAAG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01017-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005909_AF2.pdbhor005909_ESM.pdb

Physical Information

Mass: 144318 Formula: C61H87N17O14
Absent amino acids: ACEGIKMNQSTW Common amino acids: HV
pI: 7.71 Basic residues: 3
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -23 Boman Index: -1712
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 97
Instability Index: 1030 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  13403900
  • Title:  The amino acid sequence in a hypertensin.